- C21orf58 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-85912
- C21orf58
- Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- Human
- This antibody was developed against Recombinant Protein corresponding to amino acids: LQSSPAAPTM LDSSAAEQVT RLTLKLLGQK LEQERQNVEG GPEGLHLEPG NEDRPDDALQ TALKRRRDLL QR
- 0.1 ml (also 25ul)
- PBS (pH 7.2) and 40% Glycerol
- Rabbit
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
- Immunogen affinity purified
- chromosome 21 open reading frame 58
- Unconjugated
Sequence
LQSSPAAPTMLDSSAAEQVTRLTLKLLGQKLEQERQNVEGGPEGLHLEPGNEDRPDDALQTALKRRRDLLQR
Specifications/Features
Available conjugates: Unconjugated